PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676757414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family EIL
Protein Properties Length: 453aa    MW: 51469.4 Da    PI: 5.0905
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676757414genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3387.32.3e-118232732257
                XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekvef 101
                elk+rmwkdq+l+++ k +k+++    ++ +    + ++ e++rrkkm+r+QD++LkYM+k+m vc+a+GfvYgi+pe+gkp +g+sdsLr+WWke+v+f
  676757414  23 ELKRRMWKDQILMEKFKLQKRHNN---DV-VAL--TTHRAEASRRKKMARSQDSVLKYMMKIMDVCRARGFVYGIVPENGKPISGSSDSLRRWWKENVQF 116
                9*************9999999954...43.222..34799************************************************************ PP

                XXXXXXXXXXX.....XXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT.--TT--.--- CS
       EIN3 102 drngpaaisky.....qaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelg.lskdqgtppy 195
                d ++p+ais+y     +a++li    +++ +++ss  h+l+elqDTtlgSLLsalmqhc ppqrrfplekg++pPWWPtG+elwwg++g ++ ++g+ppy
  676757414 117 DETAPNAISDYitlaaAAAELI----DNS-SSSSSLLHMLHELQDTTLGSLLSALMQHCVPPQRRFPLEKGIAPPWWPTGTELWWGQQGaAASEHGAPPY 211
                ***********96653333333....222.237899*****************************************************7788888**** PP

                --GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S CS
       EIN3 196 kkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekec 257
                +kphdl+k wkvsvL+avikhmsp++ ++r+l+rqsk+lqdkm+a e++++++vlnqee+++
  676757414 212 RKPHDLRKSWKVSVLAAVIKHMSPNLGRVRRLARQSKCLQDKMMATETDTWSRVLNQEEALL 273
                ***********************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.5E-11723270No hitNo description
Gene3DG3DSA:1.10.3180.105.2E-67142274IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.4E-58148273IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MVEVEELEPL APAEDEEEIS YSELKRRMWK DQILMEKFKL QKRHNNDVVA LTTHRAEASR  60
RKKMARSQDS VLKYMMKIMD VCRARGFVYG IVPENGKPIS GSSDSLRRWW KENVQFDETA  120
PNAISDYITL AAAAAELIDN SSSSSSLLHM LHELQDTTLG SLLSALMQHC VPPQRRFPLE  180
KGIAPPWWPT GTELWWGQQG AAASEHGAPP YRKPHDLRKS WKVSVLAAVI KHMSPNLGRV  240
RRLARQSKCL QDKMMATETD TWSRVLNQEE ALLKIKDVKI TEDQDQEPSG SKRKGDFVEP  300
TKSVYTCQNS SCPKSDVSFG FVDKNSRIGH EIQCLYGSSA KEPSQSTGDT ISVLETSIGT  360
NTTSEDDYSV SSSATDRRNN DDGHSHDGNW TDYLWFDRMQ HELNCSRRFE DDDDSVMDLN  420
QFPESDPSDN MNQSAFSVWD MGCEDKDIYM SDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-561492724126Protein ETHYLENE INSENSITIVE 3
4zds_B2e-561492724126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2400950.0AC240095.1 Sisymbrium irio clone SIR-11A02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010422888.10.0PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9LX160.0EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLC3UJS50.0C3UJS5_ARAAL; Putative ethylene insensitive 3 protein
STRINGfgenesh2_kg.6__972__AT5G10120.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58792747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.10.0EIL family protein